Recombinant Neisseria meningitidis serogroup B / serotype 15 Major outer membrane protein P.IB (porB) | CSB-EP518750NGH

(No reviews yet) Write a Review
SKU:
CSB-EP518750NGH
Availability:
3 - 7 Working Days
  • Recombinant Neisseria meningitidis serogroup B / serotype 15 Major outer membrane protein P.IB (porB)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$422.40 - $2,042.40

Description

Recombinant Neisseria meningitidis serogroup B / serotype 15 Major outer membrane protein P.IB (porB) | CSB-EP518750NGH | Cusabio

Alternative Name(s): Class 3 protein Porin

Gene Names: porB

Research Areas: Signal Transduction

Organism: Neisseria meningitidis serogroup B / serotype 15 (strain H44/76)

AA Sequence: DVTLYGTIKAGVETSRSVFHQNGQVTEVTTATGIVDLGSKIGFKGQEDLGNGLKAIWQVEQKASIAGTDSGWGNRQSFIGLKGGFGKLRVGRLNSVLKDTGDINPWDSKSDYLGVNKIAEPEARLISVRYDSPEFAGLSGSVQYALNDNAGRHNSESYHAGFNYKNGGFFVQYGGAYKRHHQVQEGLNIEKYQIHRLVSGYDNDALYASVAVQQQDAKLTDASNSHNSQTEVAATLAYRFGNVTPRVSYAHGFKGLVDDADIGNEYDQVVVGAEYDFSKRTSALVSAGWLQEGKGENKFVATAGGVGLRHKF

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 20-331aa

Sequence Info: Full Length of Mature Protein

MW: 49.8 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Serves as a slightly cation selective porin.

Reference: "Neisseria meningitidis is structured in clades associated with restriction modification systems that modulate homologous recombination." Budroni S., Siena E., Hotopp J.C., Seib K.L., Serruto D., Nofroni C., Comanducci M., Riley D.R., Daugherty S.C., Angiuoli S.V., Covacci A., Pizza M., Rappuoli R., Moxon E.R., Tettelin H., Medini D.Proc. Natl. Acad. Sci. U.S.A. 108:4494-4499(2011)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Serves as a slightly cation selective porin.

Involvement in disease:

Subcellular Location: Cell outer membrane, Multi-pass membrane protein

Protein Families: Gram-negative porin family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: E6MZM0

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: KEGG

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose