Recombinant Neisseria meningitidis serogroup B Major outer membrane protein P.IB (porB) | CSB-EP326992NBK

Recombinant Neisseria meningitidis serogroup B Major outer membrane protein P.IB (porB) | CSB-EP326992NBK | Cusabio

Alternative Name(s): Class 3 protein Porin

Gene Names: porB

Research Areas: Signal Transduction

Organism: Neisseria meningitidis serogroup B

AA Sequence: DVTLYGTIKAGVETSRSVAHNGAQAASVETGTGIVDLGSKIGFKGQEDLGNGLKAIWQVEQKASIAGTDSGWGNRQSFIGLKGGFGKLRVGRLNSVLKDTGDINPWDSKSDYLGVNKIAEPEARLISVRYDSPEFAGLSGSVQYALNDNAGRHNSESYHAGFNYKNGGFFVQYGGAYKRHHRVQEDINIEKYQIHRLVSGYDNDALHASVAVQQQDAKLVEENYSHNSQTEVAATLAYRFGNVTPRVSYAHGFRGLVDSADYTNDYDQVVVGAEYDFSKRTSALVSAGWLQEGKGKNKFVSTAGGVGLRHKF

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 20-331aa

Sequence Info: Full Length of Mature Protein

MW: 37.9 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Serves as a slightly cation selective porin.

Reference: "Sequence analysis and relationships between meningococcal class 3 serotype proteins and other porins from pathogenic and non-pathogenic Neisseria species." Ward M.J., Lambden P.R., Heckels J.E. FEMS Microbiol. Lett. 73:283-289(1992)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Serves as a slightly cation selective porin.

Involvement in disease:

Subcellular Location: Cell outer membrane, Multi-pass membrane protein

Protein Families: Gram-negative porin family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P30689

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A