Recombinant Mouse Tumor necrosis factor receptor superfamily member 4 (Tnfrsf4), partial | CSB-EP023981MO

Recombinant Mouse Tumor necrosis factor receptor superfamily member 4 (Tnfrsf4), partial | CSB-EP023981MO | Cusabio

Alternative Name(s): OX40 antigen OX40L receptor CD_antigen: CD134

Gene Names: Tnfrsf4

Research Areas: Others

Organism: Mus musculus (Mouse)

AA Sequence: VTARRLNCVKHTYPSGHKCCRECQPGHGMVSRCDHTRDTLCHPCETGFYNEAVNYDTCKQCTQCNHRSGSELKQNCTPTQDTVCRCRPGTQPRQDSGYKLGVDCVPCPPGHFSPGNNQACKPWTNCTLSGKQTRHPASDSLDAVCEDRSLLATLLWETQRPTFRPTTVQSTTVWPRTSELPSPPTLVTPEGP

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 20-211aa

Sequence Info: Extracellular Domain

MW: 37.3 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Receptor for TNFSF4/OX40L/GP34. Is a costimulatory molecule implicated in long-term T-cell immunity (By similarity).

Reference: "Cloning of mouse Ox40: a T cell activation marker that may mediate T-B cell interactions."Calderhead D.M., Buhlmann J.E., van den Eertwegh A.J., Claassen E., Noelle R.J., Fell H.J. Immunol. 151:5261-5271(1993)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Receptor for TNFSF4/OX40L/GP34. Is a costimulatory molecule implicated in long-term T-cell immunity (By similarity).

Involvement in disease:

Subcellular Location: Membrane, Single-pass type I membrane protein

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P47741

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A