Recombinant Mouse Tumor necrosis factor receptor superfamily member 17 (Tnfrsf17), partial | CSB-MP023974MO1

Recombinant Mouse Tumor necrosis factor receptor superfamily member 17 (Tnfrsf17), partial | CSB-MP023974MO1 | Cusabio

Alternative Name(s): B-cell maturation protein (CD_antigen: CD269) (Bcm) (Bcma)

Gene Names: Tnfrsf17

Research Areas: Cancer

Organism: Mus musculus (Mouse)

AA Sequence: MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNA

Source: Mammalian cell

Tag Info: C-terminal hFc-tagged

Expression Region: 1-54aa

Sequence Info: Partial

MW: 34.8 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Receptor for TNFSF13B/BLyS/BAFF and TNFSF13/APRIL. Promotes B-cell survival and plays a role in the regulation of humoral immunity. Activates NF-kappa-B and JNK.

Reference: "BCMA is essential for the survival of long-lived bone marrow plasma cells." O'Connor B.P., Raman V.S., Erickson L.D., Cook W.J., Weaver L.K., Ahonen C., Lin L.L., Mantchev G.T., Bram R.J., Noelle R.J. J. Exp. Med. 199:91-98(2004)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: O88472

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A