Recombinant Mouse Single-stranded DNA cytosine deaminase (Aicda) | CSB-BP001487MO

Recombinant Mouse Single-stranded DNA cytosine deaminase (Aicda) | CSB-BP001487MO | Cusabio

Alternative Name(s): Activation-induced cytidine deaminase (AID) (Cytidine aminohydrolase)

Gene Names: Aicda

Research Areas: Epigenetics and Nuclear Signaling

Organism: Mus musculus (Mouse)

AA Sequence: MDSLLMKQKKFLYHFKNVRWAKGRHETYLCYVVKRRDSATSCSLDFGHLRNKSGCHVELLFLRYISDWDLDPGRCYRVTWFTSWSPCYDCARHVAEFLRWNPNLSLRIFTARLYFCEDRKAEPEGLRRLHRAGVQIGIMTFKDYFYCWNTFVENRERTFKAWEGLHENSVRLTRQLRRILLPLYEVDDLRDAFRMLGF

Source: Baculovirus

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Expression Region: 1-198aa

Sequence Info: Full Length

MW: 27.9

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Single-stranded DNA-specific cytidine deaminase. Involved in somatic hypermutation , gene conversion, and class-switch recombination in B-lymphocytes by deaminating C to U during transcription of Ig-variable and Ig-switch region DNA. Required for several crucial steps of B-cell terminal differentiation necessary for efficient antibody responses. May also play a role in the epigenetic regulation of gene expression by participating in DNA demethylation.

Reference: "Transcription-targeted DNA deamination by the AID antibody diversification enzyme." Chaudhuri J., Tian M., Khuong C., Chua K., Pinaud E., Alt F.W. Nature 422:726-730(2003)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q9WVE0

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A