Recombinant Mouse Prolactin-3D1 (Prl3d1) | CSB-EP325555MO

(No reviews yet) Write a Review
SKU:
CSB-EP325555MO
Availability:
13 - 23 Working Days
  • Recombinant Mouse Prolactin-3D1 (Prl3d1)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£238.40 - £1,361.60

Description

Recombinant Mouse Prolactin-3D1 (Prl3d1) | CSB-EP325555MO | Cusabio

Alternative Name(s): Chorionic somatomammotropin hormone 1 Placental lactogen I

Gene Names: Prl3d1

Research Areas: Others

Organism: Mus musculus (Mouse)

AA Sequence: SKPTAMVPTEDLYTRLAELLHNTFILAADVYREFDLDFFDKTWITDRTLPLCHTASIHTPENREEVHETKTEDLLKAMINVSISWKEPLKHLVSALTALPGASESMGKKAADIKGRNLVILEGLQTIYNRSQANIEENENFDYPAWSGLEELQSPNEDTHLFAVYNLCRCIKRDIHKIDSYIKVLRCRVVFQNEC

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 30-224aa

Sequence Info: Full Length of Mature Protein

MW: 26.4 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance:

Reference: "Trophoblast-specific transcription from the mouse placental lactogen-I gene promoter." Shida M.M., Ng Y.K., Soares M.J., Linzer D.I.H. Mol. Endocrinol. 7:181-188(1993)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location: Secreted

Protein Families: Somatotropin/prolactin family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P18121

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: N/A

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose