Recombinant Mouse Prolactin receptor (Prlr), partial (Active) | CSB-MP018727MO

Recombinant Mouse Prolactin receptor (Prlr) ,partial (Active) | CSB-MP018727MO | Cusabio

Protein Description: Partial

Alternative Name (s) : (PRL-R)

Gene Names: Prlr

Research Areas: Signal Transduction

Species: Mus musculus (Mouse)

Source: Mammalian cell

Tag Info: C-terminal 10xHis-tagged

Expression Region: 20-229aa

Sequence Info: QSPPGKPEIHKCRSPDKETFTCWWNPGSDGGLPTNYSLTYSKEGEKNTYECPDYKTSGPNSCFFSKQYTSIWKIYIITVNATNEMGSSTSDPLYVDVTYIVEPEPPRNLTLEVKQLKDKKTYLWVKWLPPTITDVKTGWFTMEYEIRLKSEEADEWEIHFTGHQTQFKVFDLYPGQKYLVQTRCKPDHGYWSRWGQEKSIEIPNDFTLKD

Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Mouse Prlr at 5 μg/mL can bind Anti-PRLR recombinant antibody (CSB-RA018727A0HU) , the EC50 is 4.021-8.706 ng/mL.

MW: 27.3 kDa

Purity: Greater than 95% as determined by SDS-PAGE.

Endotoxin: Less than 1.0 EU/ug as determined by LAL method.

Relevance: This is a receptor for the anterior pituitary hormone prolactin.

PubMed ID:

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Lyophilized powder

Buffer: Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q08501

Uniprot Entry Name:

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A