Recombinant Mouse Prohibitin (Phb), partial | CSB-EP017885MO1

Recombinant Mouse Prohibitin (Phb), partial | CSB-EP017885MO1 | Cusabio

Alternative Name(s): B-cell receptor-associated protein 32 (BAP 32)

Gene Names: Phb

Research Areas: Cancer

Organism: Mus musculus (Mouse)

AA Sequence: MAAKVFESIGKFGLALAVAGGVVNSALYNVDAGHRAVIFD

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 1-40aa

Sequence Info: Partial

MW: 8.1 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Prohibitin inhibits DNA synthesis. It has a role in regulating proliferation. As yet it is unclear if the protein or the mRNA exhibits this effect. May play a role in regulating mitochondrial respiration activity and in aging.

Reference: "Mammalian prohibitin proteins respond to mitochondrial stress and decrease during cellular senescence." Coates P.J., Nenutil R., McGregor A., Picksley S.M., Crouch D.H., Hall P.A., Wright E.G. Exp. Cell Res. 265:262-273(2001)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Prohibitin inhibits DNA synthesis. It has a role in regulating proliferation. As yet it is unclear if the protein or the mRNA exhibits this effect. May play a role in regulating mitochondrial respiration activity and in aging (By similarity).

Involvement in disease:

Subcellular Location: Mitochondrion inner membrane

Protein Families: Prohibitin family

Tissue Specificity: Widely expressed in different tissues.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P67778

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A