Recombinant Mouse Neuropeptide Y receptor type 2 (Npy2r), partial | CSB-EP016036MO1b0

Recombinant Mouse Neuropeptide Y receptor type 2 (Npy2r), partial | CSB-EP016036MO1b0 | Cusabio

Alternative Name(s): NPY-Y2 receptor (Y2 receptor)

Gene Names: Npy2r

Research Areas: Cardiovascular

Organism: Mus musculus (Mouse)

AA Sequence: MGPVGAEADENQTVEVKVEPYGPGHTTPRGELPPDPEPELIDSTKLVEVQV

Source: E.coli

Tag Info: N-terminal 10xHis-tagged

Expression Region: 1-51aa

Sequence Info: Partial

MW: 11.0 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Receptor for neuropeptide Y and peptide YY.

Reference: "Normal feeding behavior, body weight and leptin response require the neuropeptide Y Y2 receptor." Naveilhan P., Hassani H., Canals J.M., Ekstrand A.J., Larefalk A., Chhajlani V., Arenas E., Gedda K., Svensson L., Thoren P., Ernfors P. Nat. Med. 5:1188-1193(1999)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Receptor for neuropeptide Y and peptide YY.

Involvement in disease:

Subcellular Location: Cell membrane, Multi-pass membrane protein

Protein Families: G-protein coupled receptor 1 family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P97295

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A