Recombinant Mouse Monoglyceride lipase (Mgll) | CSB-YP013787MO

(No reviews yet) Write a Review
SKU:
CSB-YP013787MO
Availability:
25 - 35 Working Days
  • Recombinant Mouse Monoglyceride lipase (Mgll)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$406.80 - $1,614.00

Description

Recombinant Mouse Monoglyceride lipase (Mgll) | CSB-YP013787MO | Cusabio

Alternative Name(s): Short name: MGL Alternative name(s): Monoacylglycerol lipase Short name: MAGL

Gene Names: Mgll

Research Areas: Cardiovascular

Organism: Mus musculus (Mouse)

AA Sequence: MPEASSPRRTPQNVPYQDLPHLVNADGQYLFCRYWKPSGTPKALIFVSHGAGEHCGRYDELAHMLKGLDMLVFAHDHVGHGQSEGERMVVSDFQVFVRDVLQHVDTIQKDYPDVPIFLLGHSMGGAISILVAAERPTYFSGMVLISPLVLANPESASTLKVLAAKLLNFVLPNMTLGRIDSSVLSRNKSEVDLYNSDPLVCRAGLKVCFGIQLLNAVARVERAMPRLTLPFLLLQGSADRLCDSKGAYLLMESSRSQDKTLKMYEGAYHVLHRELPEVTNSVLHEVNSWVSHRIAAAGAGCPP

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 1-303aa

Sequence Info: Full Length

MW: 35.4 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Converts monoacylglycerides to free fatty acids and glycerol. Hydrolyzes the endocannabinoid 2-arachidonoylglycerol, and thereby contributes to the regulation of endocannabinoid signaling, nociperception and perception of pain (PubMed:9341166, PubMed:17700715, PubMed:18096503, PubMed:19029917, PubMed:20729846). Regulates the levels of fatty acids that serve as signaling molecules and promote cancer cell migration, invasion and tumor growth (By similarity).

Reference: "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."The MGC Project Team Genome Res. 14:2121-2127(2004).

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Converts monoacylglycerides to free fatty acids and glycerol. Hydrolyzes the endocannabinoid 2-arachidonoylglycerol, and thereby contributes to the regulation of endocannabinoid signaling, nociperception and perception of pain

Involvement in disease:

Subcellular Location: Cytoplasm, cytosol, Membrane, Peripheral membrane protein

Protein Families: AB hydrolase superfamily, Monoacylglycerol lipase family

Tissue Specificity: Ubiquitous.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: O35678

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose