Recombinant Mouse Monoglyceride lipase (Mgll) | CSB-EP013787MOa2

Recombinant Mouse Monoglyceride lipase (Mgll) | CSB-EP013787MOa2 | Cusabio

Alternative Name(s): Monoacylglycerol lipase

Gene Names: Mgll

Research Areas: Cardiovascular

Organism: Mus musculus (Mouse)

AA Sequence: MPEASSPRRTPQNVPYQDLPHLVNADGQYLFCRYWKPSGTPKALIFVSHGAGEHCGRYDELAHMLKGLDMLVFAHDHVGHGQSEGERMVVSDFQVFVRDVLQHVDTIQKDYPDVPIFLLGHSMGGAISILVAAERPTYFSGMVLISPLVLANPESASTLKVLAAKLLNFVLPNMTLGRIDSSVLSRNKSEVDLYNSDPLVCRAGLKVCFGIQLLNAVARVERAMPRLTLPFLLLQGSADRLCDSKGAYLLMESSRSQDKTLKMYEGAYHVLHRELPEVTNSVLHEVNSWVSHRIAAAGAGCPP

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 1-303aa

Sequence Info: Full Length

MW: 49.4 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Converts monoacylglycerides to free fatty acids and glycerol. Hydrolyzes the endocannabinoid 2-arachidonoylglycerol, and thereby contributes to the regulation of endocannabinoid signaling, nociperception and perception of pain. Regulates the levels of fatty acids that serve as signaling molecules and promote cancer cell migration, invasion and tumor growth

Reference: "Exon-intron organization and chromosomal localization of the mouse monoglyceride lipase gene." Karlsson M., Reue K., Xia Y.-R., Lusis A.J., Langin D., Tornqvist H., Holm C. Gene 272:11-18(2001)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Converts monoacylglycerides to free fatty acids and glycerol. Hydrolyzes the endocannabinoid 2-arachidonoylglycerol, and thereby contributes to the regulation of endocannabinoid signaling, nociperception and perception of pain

Involvement in disease:

Subcellular Location: Cytoplasm, cytosol, Membrane, Peripheral membrane protein

Protein Families: AB hydrolase superfamily, Monoacylglycerol lipase family

Tissue Specificity: Ubiquitous.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: O35678

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A