Recombinant Mouse Lymphocyte antigen 6E (Ly6e) | CSB-EP717533MO

Recombinant Mouse Lymphocyte antigen 6E (Ly6e) | CSB-EP717533MO | Cusabio

Alternative Name(s): Stem cell antigen 2 Thymic shared antigen 1

Gene Names: Ly6e

Research Areas: Immunology

Organism: Mus musculus (Mouse)

AA Sequence: LMCFSCTDQKNNINCLWPVSCQEKDHYCITLSAAAGFGNVNLGYTLNKGCSPICPSENVNLNLGVASVNSYCCQSSFCNFSA

Source: E.coli

Tag Info: N-terminal 6xHis-B2M-tagged

Expression Region: 21-102aa

Sequence Info: Full Length of Mature Protein

MW: 22.8 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Involved in T-cell development.

Reference: "Characterization of Ly-6M, a novel member of the Ly-6 family of hematopoietic proteins." Patterson J.M.M., Johnson M.H., Zimonjic D.B., Graubert T.A. Blood 95:3125-3132(2000)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Involved in T-cell development

Involvement in disease:

Subcellular Location: Cell membrane, Lipid-anchor, GPI-anchor

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q64253

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A