Recombinant Mouse Interleukin-1 beta (Il1b) (Active) | CSB-AP004731MO

(No reviews yet) Write a Review
SKU:
CSB-AP004731MO
Availability:
5 to 10 Working Days
  • Recombinant Mouse Interleukin-1 beta (Il1b) (Active)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$345.60 - $782.40

Description

Recombinant Mouse Interleukin-1 beta (Il1b) (Active) | CSB-AP004731MO | Cusabio

Protein Description: Full Length of Mature Protein

Alternative Name (s) : Interleukin-1 Beta; IL-1 Beta; Il1b

Gene Names: Il1b

Research Areas: Immunology

Species: Mus musculus (Mouse)

Source: E.coli

Tag Info: Tag-Free

Expression Region: 118-269aa

Sequence Info: VPIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVALGLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNWYISTSQAEHKPVFLGNNSGQDIIDFTMESVSS

Biological Activity: The ED50 as determined in a cell proliferation assay using mouse D10S cells is less than 20 pg/mL.

MW: 17.4 kDa

Purity: Greater than 95% as determined by SDS-PAGE.

Endotoxin: Less than 1.0 EU/µg as determined by LAL method.

Relevance: Interleukin-1 (IL-1) designates two proteins, IL-1α and IL-1β, which are the products of distinct genes, but recognize the same cell surface receptors. IL-1α and IL-1β are structurally related polypeptides that show approximately 25% homology at the amino acid level. Both proteins are produced by a wide variety of cells in response to stimuli such as those produced by inflammatory agents, infections, or microbial endotoxins. The proteins are synthesized as 31 kDa precursors that are subsequently cleaved into proteins with molecular weights of approximately 17.5 kDa. The specific protease responsible for the processing of IL-1β, designated interleukin 1β-converting enzyme (ICE) , has been described. Mature human and mouse IL-1β share approximately 75% amino acid sequence identity and human IL-1β has been found to be active on murine cell lines.

PubMed ID:

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Function: Potent proinflammatory cytokine. Initially discovered as the major endogenous pyrogen, induces prostaglandin synthesis, neutrophil influx and activation, T-cell activation and cytokine production, B-cell activation and antibody production, and fibroblast proliferation and collagen production.

Involvement in disease:

Subcellular Location: Cytoplasm, cytosol, Lysosome, Secreted, exosome, Cytoplasmic vesicle, autophagosome, Secreted

Protein Families: IL-1 family

Tissue Specificity: Expressed in activated macrophages (at protein level) .

Paythway:

Form: Lyophilized powder

Buffer: Lyophilized from a 0.2 μm Filtered 50 mM Tris-HCl, 50 mM NaCl, pH 8.0

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P10749

Uniprot Entry Name:

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose