Cusabio Mouse Recombinants
Recombinant Mouse Homeobox protein Nkx-2.2 (Nkx2-2) | CSB-EP015842MO
- SKU:
- CSB-EP015842MO
- Availability:
- 13 - 23 Working Days
Description
Recombinant Mouse Homeobox protein Nkx-2.2 (Nkx2-2) | CSB-EP015842MO | Cusabio
Alternative Name(s): Homeobox protein NK-2 homolog B
Gene Names: Nkx2-2
Research Areas: Others
Organism: Mus musculus (Mouse)
AA Sequence: MSLTNTKTGFSVKDILDLPDTNDEDGSVAEGPEEESEGPEPAKRAGPLGQGALDAVQSLPLKSPFYDSSDNPYTRWLASTEGLQYSLHGLAASAPPQDSSSKSPEPSADESPDNDKETQGGGGDAGKKRKRRVLFSKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKMKRARAEKGMEVTPLPSPRRVAVPVLVRDGKPCHALKAQDLAAATFQAGIPFSAYSAQSLQHMQYNAQYSSASTPQYPTAHPLVQAQQWTW
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
Expression Region: 1-273aa
Sequence Info: Full Length
MW: 46.1 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Acts as a transcriptional activator. Required for the maintenance of NEUROD1 expression in the horomone-producing endocrine cells of the pancreas. May be involved in specifying diencephalic neuromeric boundaries, and in controlling the expression of genes that play a role in axonal guidance. Associates with chromatin at the NEUROD1 promoter region. Binds to a subset of consensus elements within the NEUROD1 promoter.
Reference: "Regional expression of the homeobox gene Nkx-2.2 in the developing mammalian forebrain."Price M., Lazzaro D., Pohl T., Mattei M.-G., Ruether U., Olivo J.-C., Duboule D., di Lauro R.Neuron 8:241-255(1992)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Acts as a transcriptional activator. Required for the maintenance of NEUROD1 expression in the horomone-producing endocrine cells of the pancreas. May be involved in specifying diencephalic neuromeric boundaries, and in controlling the expression of genes that play a role in axonal guidance. Associates with chromatin at the NEUROD1 promoter region. Binds to a subset of consensus elements within the NEUROD1 promoter.
Involvement in disease:
Subcellular Location: Nucleus
Protein Families: NK-2 homeobox family
Tissue Specificity: Expressed in restricted areas of the developing CNS: the hindbrain and forebrain, and pancreas.
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P42586
HGNC Database Link: N/A
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: N/A