Recombinant Mouse Galectin-4 (Lgals4) | CSB-YP812998MO

Recombinant Mouse Galectin-4 (Lgals4) | CSB-YP812998MO | Cusabio

Alternative Name(s): Gal-4 Alternative name(s): Lactose-binding lectin 4

Gene Names: Lgals4

Research Areas: Tags & Cell Markers

Organism: Mus musculus (Mouse)

AA Sequence: MAYVPAPGYQPTYNPTLPYKRPIPGGLSVGMSVYIQGMAKENMRRFHVNFAVGQDDGADVAFHFNPRFDGWDKVVFNTMQSGQWGKEEKKKSMPFQKGKHFELVFMVMPEHYKVVVNGNSFYEYGHRLPVQMVTHLQVDGDLELQSINFLGGQPAAAPYPGAMTIPAYPAGSPGYNPPQMNTLPVMTGPPVFNPRVPYVGALQGGLTVRRTIIIKGYVLPTARNFVINFKVGSSGDIALHLNPRIGDSVVRNSFMNGSWGAEERKVAYNPFGPGQFFDLSIRCGMDRFKVFANGQHLFDFSHRFQAFQMVDTLEINGDITLSYVQI

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 1-326aa

Sequence Info: Full Length

MW: 38.4 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Galectin that binds lactose and a related range of sugars.

Reference: "Crystal structure of the N-terminal domain of mouse galectin-4."RIKEN structural genomics initiative (RSGI)Submitted (OCT-2007)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Galectin that binds lactose and a related range of sugars.

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity: Epithelial cells of the embryonic and adult gastrointestinal tract. Expressed at about equal levels in colon and small intestine but much less in stomach.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q8K419

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A