Recombinant Mouse Dedicator of cytokinesis protein 8 (Dock8), partial | CSB-EP807451MO1

(No reviews yet) Write a Review
SKU:
CSB-EP807451MO1
Availability:
3 - 7 Working Days
  • Recombinant Mouse Dedicator of cytokinesis protein 8 (Dock8), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£238.40 - £1,361.60

Description

Recombinant Mouse Dedicator of cytokinesis protein 8 (Dock8), partial | CSB-EP807451MO1 | Cusabio

Alternative Name(s): Dock8Dedicator of cytokinesis protein 8

Gene Names: Dock8

Research Areas: Others

Organism: Mus musculus (Mouse)

AA Sequence: RNLLYVYPQRLNFASKLASARNITIKIQFMCGEDPSNAMPVIFGKSSGPEFLQEVYTAITYHNKSPDFYEEVKIKLPAKLTVNHHLLFTFYHISCQQKQGASGESLLGYSWLPILLNERLQTGSYCLPVALEKLPPNYSIHSAEKVPLQNPPIKWAEGHKGVFNIEVQAV

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 561-730aa

Sequence Info: Partial

MW: 24.7 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Potential guanine nucleotide exchange factor (GEF). GEF proteins activate some small GTPases by exchanging bound GDP for free GTP (By similarity). Is involved in NK cell cytotoxicity controlling polarization of microtubule-organizing center (MTOC), and possibly regulating CCDC88B-mediated lytic granule transport to MTOC during cell killing

Reference: "Prediction of the coding sequences of mouse homologues of FLJ genes: the complete nucleotide sequences of 110 mouse FLJ-homologous cDNAs identified by screening of terminal sequences of cDNA clones randomly sampled from size-fractionated libraries." Okazaki N., Kikuno R., Ohara R., Inamoto S., Koseki H., Hiraoka S., Saga Y., Kitamura H., Nakagawa T., Nagase T., Ohara O., Koga H. DNA Res. 11:127-135(2004)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Guanine nucleotide exchange factor (GEF) which specifically activates small GTPase CDC42 by exchanging bound GDP for free GTP

Involvement in disease:

Subcellular Location: Cytoplasm, Cell membrane, Peripheral membrane protein, Cytoplasmic side, Cell projection, lamellipodium membrane, Peripheral membrane protein, Cytoplasmic side

Protein Families: DOCK family

Tissue Specificity: Expressed in T cells (PubMed:28028151). Expressed in bone marrow-derived dendritic cells (PubMed:25713392).

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q8C147

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose