Cusabio Human Recombinants
Recombinant Human Dedicator of cytokinesis protein 8 (DOCK8), partial | CSB-YP836734HUb0
- SKU:
- CSB-YP836734HUb0
- Availability:
- 3 - 7 Working Days
Description
Recombinant Human Dedicator of cytokinesis protein 8 (DOCK8), partial | CSB-YP836734HUb0 | Cusabio
Alternative Name(s): DOCK8Dedicator of cytokinesis protein 8
Gene Names: DOCK8
Research Areas: Others
Organism: Homo sapiens (Human)
AA Sequence: RNLLYVYPQRLNFVNKLASARNITIKIQFMCGEDASNAMPVIFGKSSGPEFLQEVYTAVTYHNKSPDFYEEVKIKLPAKLTVNHHLLFTFYHISCQQKQGASVETLLGYSWLPILLNERLQTGSYCLPVALEKLPPNYSMHSAEKVPLQNPPIKWAEGHKGVFNIEVQAV
Source: Yeast
Tag Info: N-terminal 10xHis-tagged
Expression Region: 560-729aa
Sequence Info: Partial
MW: 21.8 kDa
Purity: Greater than 85% as determined by SDS-PAGE.
Relevance: Potential guanine nucleotide exchange factor (GEF). GEF proteins activate some small GTPases by exchanging bound GDP for free GTP. Is involved in NK cell cytotoxicity by controlling polarization of microtubule-organizing center (MTOC), and possibly regulating CCDC88B-mediated lytic granule transport to MTOC during cell killing
Reference: "The region on 9p associated with 46,XY sex reversal contains several transcripts expressed in the urogenital system and a novel doublesex-related domain." Ottolenghi C., Veitia R., Quintana-Murci L., Torchard D., Scapoli L., Souleyreau-Therville N., Beckmann J., Fellous M., McElreavey K. Genomics 64:170-178(2000)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Guanine nucleotide exchange factor (GEF) which specifically activates small GTPase CDC42 by exchanging bound GDP for free GTP
Involvement in disease: Hyperimmunoglobulin E recurrent infection syndrome, autosomal recessive (AR-HIES); Mental retardation, autosomal dominant 2 (MRD2)
Subcellular Location: Cytoplasm, Cell membrane, Peripheral membrane protein, Cytoplasmic side, Cell projection, lamellipodium membrane, Peripheral membrane protein, Cytoplasmic side
Protein Families: DOCK family
Tissue Specificity: Expressed in peripheral blood mononuclear cells (PBMCs).
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: Q8NF50
HGNC Database Link: HGNC
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: OMIM