Recombinant Mouse Complement receptor type 2 (Cr2), partial | CSB-EP005934MO1

Recombinant Mouse Complement receptor type 2 (Cr2), partial | CSB-EP005934MO1 | Cusabio

Alternative Name(s): Complement C3d receptor CD_antigen: CD21

Gene Names: Cr2

Research Areas: Immunology

Organism: Mus musculus (Mouse)

AA Sequence: ISCDPPPEVKNARKPYYSLPIVPGTVLRYTCSPSYRLIGEKAIFCISENQVHATWDKAPPICESVNKTISCSDPIVPGGFMNKGSKAPFRHGDSVTFTCKANFTMKGSKTVWCQANEMWGPTALPVCES

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 12-140aa

Sequence Info: Partial

MW: 18.1 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Receptor for complement C3d. Participates in B lymphocytes activation.

Reference: "Comparative structure and evolution of murine CR2. The homolog of the human C3d/EBV receptor (CD21)."Fingeroth J.D.J. Immunol. 144:3458-3467(1990)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Receptor for complement C3d and for HNRNPU. Participates in B lymphocytes activation.

Involvement in disease:

Subcellular Location: Membrane, Single-pass type I membrane protein

Protein Families: Receptors of complement activation (RCA) family

Tissue Specificity: B-lymphocytes.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P19070

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: N/A

STRING Database Link: STRING

OMIM Database Link: N/A