Recombinant Mouse Chymotrypsin-like elastase family member 2A (Cela2a) | CSB-YP005196MO

(No reviews yet) Write a Review
SKU:
CSB-YP005196MO
Availability:
25 - 35 Working Days
  • Recombinant Mouse Chymotrypsin-like elastase family member 2A (Cela2a)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$357.60 - $1,362.00

Description

Recombinant Mouse Chymotrypsin-like elastase family member 2A (Cela2a) | CSB-YP005196MO | Cusabio

Alternative Name(s): Elastase-2 Elastase-2A

Gene Names: Cela2a

Research Areas: Others

Organism: Mus musculus (Mouse)

AA Sequence: VVGGQEATPNTWPWQVSLQVLSSGRWRHNCGGSLVANNWVLTAAHCLSNYQTYRVLLGAHSLSNPGAGSAAVQVSKLVVHQRWNSQNVGNGYDIALIKLASPVTLSKNIQTACLPPAGTILPRNYVCYVTGWGLLQTNGNSPDTLRQGRLLVVDYATCSSASWWGSSVKSSMVCAGGDGVTSSCNGDSGGPLNCRASNGQWQVHGIVSFGSSLGCNYPRKPSVFTRVSNYIDWINSVMARN

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 31-271aa

Sequence Info: Full Length of Mature Protein

MW: 27.7 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Acts upon elastin.

Reference: "Wnk1 kinase deficiency lowers blood pressure in mice: a gene-trap screen to identify potential targets for therapeutic intervention." Zambrowicz B.P., Abuin A., Ramirez-Solis R., Richter L.J., Piggott J., BeltrandelRio H., Buxton E.C., Edwards J., Finch R.A., Friddle C.J., Gupta A., Hansen G., Hu Y., Huang W., Jaing C., Key B.W. Jr., Kipp P., Kohlhauff B. Sands A.T.Proc. Natl. Acad. Sci. U.S.A. 100:14109-14114(2003)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Acts upon elastin.

Involvement in disease:

Subcellular Location: Secreted

Protein Families: Peptidase S1 family, Elastase subfamily

Tissue Specificity: Pancreas.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P05208

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose