Recombinant Mouse Chymase (Cma1), partial | CSB-EP005599MO

(No reviews yet) Write a Review
SKU:
CSB-EP005599MO
Availability:
3 - 7 Working Days
£238.40 - £1,361.60

Description

Recombinant Mouse Chymase (Cma1), partial | CSB-EP005599MO | Cusabio

Alternative Name(s): Alpha-chymase;Mast cell chymase 1Mast cell protease 5 ;mMCP-5Mast cell protease I

Gene Names: Cma1

Research Areas: Others

Organism: Mus musculus (Mouse)

AA Sequence: IIGGTECIPHSRPYMAYLEIVTSENYLSACSGFLIRRNFVLTAAHCAGRSITVLLGAHNKTSKEDTWQKLEVEKQFLHPKYDENLVVHDIMLLKLKEKAKLTLGVGTLPLSANFNFIPPGRMCRAVGWGRTNVNEPASDTLQEVKMRLQEPQACKHFTSFRHNSQLCVGNPKKMQNVYKGDSGGPLLCAGIAQGIASYVHRNAKPPAVFTRISHYRPWINKILRE

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 22-246aa

Sequence Info: Partial

MW: 29.2 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Major secreted protease of mast cells with suspected roles in vasoactive peptide generation, Extracellular domain matrix degradation, and regulation of gland secretion.

Reference: Characterization of the gene encoding mouse mast cell protease 8 (mMCP-8),and a comparative analysis of hematopoietic serine protease genes.Lunderius C., Hellman L.Immunogenetics 53:225-232(2001)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Major secreted protease of mast cells with suspected roles in vasoactive peptide generation, extracellular matrix degradation, and regulation of gland secretion.

Involvement in disease:

Subcellular Location: Secreted, Cytoplasmic granule

Protein Families: Peptidase S1 family, Granzyme subfamily

Tissue Specificity: Mast cells.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P21844

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose