Cusabio Canis lupus familiaris Recombinants
Recombinant Dog Chymase (CMA1) | CSB-EP005599DO
- SKU:
- CSB-EP005599DO
- Availability:
- 3 - 7 Working Days
Description
Recombinant Dog Chymase (CMA1) | CSB-EP005599DO | Cusabio
Alternative Name(s): Alpha-chymase;Mast cell protease I
Gene Names: CMA1
Research Areas: Others
Organism: Canis lupus familiaris (Dog) (Canis familiaris)
AA Sequence: IIGGTESKPHSRPYMAHLEILTLRNHLASCGGFLIRRNFVLTAAHCAGRFIMVTLGAHNIQKKEDTWQKLEVIKQFPHPKYDDLTLRHDIMLLKLKEKANLTLAVGTLPLSPQFNFVPPGRMCRVAGWGKRQVNGSGSDTLQEVKLRLMDPQACRHYMAFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGQNDAKPPAVFTRISHYRPWINKVLKQNKA
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
Expression Region: 22-249aa
Sequence Info: Full Length of Mature Protein
MW: 41.5 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Major secreted protease of mast cells with suspected roles in vasoactive peptide generation, Extracellular domain matrix degradation, and regulation of gland secretion.
Reference: Purification and characterization of dog mastocytoma chymase identification of an octapeptide conserved in chymotryptic leukocyte proteinases.Caughey G.H., Viro N.F., Lazarus S.C., Nadel J.A.Biochim. Biophys. Acta 952:142-149(1988)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Major secreted protease of mast cells with suspected roles in vasoactive peptide generation, extracellular matrix degradation, and regulation of gland secretion.
Involvement in disease:
Subcellular Location: Secreted, Cytoplasmic granule
Protein Families: Peptidase S1 family, Granzyme subfamily
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P21842
HGNC Database Link: N/A
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: N/A