Recombinant Mouse CB1 cannabinoid receptor-interacting protein 1 (Cnrip1) | CSB-YP705797MO

(No reviews yet) Write a Review
SKU:
CSB-YP705797MO
Availability:
25 - 35 Working Days
  • Recombinant Mouse CB1 cannabinoid receptor-interacting protein 1 (Cnrip1)
  • The reducing (R) protein migrates as 26 kDa in SDS-PAGE may be due to glycosylation.
$406.80 - $1,614.00

Description

Recombinant Mouse CB1 cannabinoid receptor-interacting protein 1 (Cnrip1) | CSB-YP705797MO | Cusabio

Alternative Name(s): Cnrip1CB1 cannabinoid receptor-interacting protein 1; CRIP-1

Gene Names: Cnrip1

Research Areas: Neuroscience

Organism: Mus musculus (Mouse)

AA Sequence: MGDLPGLVRLSIALRIQPNDGPVFFKVDGQRFGQNRTIKLLTGSSYKVEVKIKPTTLQVENISIGGVLVPLELKGKEPDGERVVYTGIYDTEGVAPTKSGERQPIQITMPFTDIGTFETVWQVKFYNYHKRDHCQWGSPFSVIEYECKPNETRSLMWVNKESFL

Source: Yeast

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Expression Region: 1-464aa

Sequence Info: Full Length

MW: 22.6 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Suppresses cannabinoid receptor CNR1-mediated tonic inhibition of voltage-gated calcium channels.

Reference: "CB1 cannabinoid receptor activity is modulated by the cannabinoid receptor interacting protein CRIP 1a." Niehaus J.L., Liu Y., Wallis K.T., Egertova M., Bhartur S.G., Mukhopadhyay S., Shi S., He H., Selley D.E., Howlett A.C., Elphick M.R., Lewis D.L. Mol. Pharmacol. 72:1557-1566(2007)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Suppresses cannabinoid receptor CNR1-mediated tonic inhibition of voltage-gated calcium channels.

Involvement in disease:

Subcellular Location:

Protein Families: CNRIP family

Tissue Specificity: Highly expressed in brain. Also detected in heart, lung, intestine, kidney, testis, spleen, liver and muscle (at protein level).

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q5M8N0

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose