Recombinant Mouse Acid ceramidase (Asah1), partial | CSB-CF895296MO

(No reviews yet) Write a Review
SKU:
CSB-CF895296MO
Availability:
18 - 23 Working Days
  • Recombinant Mouse Acid ceramidase (Asah1), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$772.80 - $1,082.40

Description

Recombinant Mouse Acid ceramidase (Asah1), partial | CSB-CF895296MO | Cusabio

Alternative Name(s): Acylsphingosine deacylase N-acylsphingosine amidohydrolase

Gene Names: Asah1

Research Areas: Signal Transduction

Organism: Mus musculus (Mouse)

AA Sequence: QAQDVPPWTEDCRKSTYPPSGPTYRGPVPWHTINLDLPPYKRWHELLAQKAPALRILVNSITSLVNTFVPSGKLMKMVDQKLPGMIGSLPDPFGEEMRGIADVTGIPLGEIISFNIFYELFTM

Source: in vitro E.coli expression system

Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Expression Region: 19-141aa

Sequence Info: Partial

MW: 33.8 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Hydrolyzes the sphingolipid ceramide into sphingosine and free fatty acid.

Reference: "Molecular cloning and characterization of a human cDNA and gene encoding a novel acid ceramidase-like protein."Hong S.-B., Li C.-M., Rhee H.-J., Park J.-H., He X., Levy B., Yoo O.J., Schuchman E.H.Genomics 62:232-241(1999)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Hydrolyzes the sphingolipid ceramide into sphingosine and free fatty acid.

Involvement in disease:

Subcellular Location: Lysosome

Protein Families: Acid ceramidase family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q9WV54

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose