Recombinant Malus domestica Major allergen Mal d 1 (MALD1) | CSB-YP331771MPS

(No reviews yet) Write a Review
SKU:
CSB-YP331771MPS
Availability:
3 - 7 Working Days
  • Recombinant Malus domestica Major allergen Mal d 1 (MALD1)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$459.60 - $1,614.00

Description

Recombinant Malus domestica Major allergen Mal d 1 (MALD1) | CSB-YP331771MPS | Cusabio

Alternative Name(s): Allergen Mal d I Allergen: Mal d 1

Gene Names: MALD1

Research Areas: Allergen

Organism: Malus domestica (Apple) (Pyrus malus)

AA Sequence: GVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFGEGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHYHTKGNIEIKEEHVKVGKEKAHGLFKLIESYLKDHPDAYN

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 2-159aa

Sequence Info: Full Length of Mature Protein

MW: 19.5 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance:

Reference: "Cloning and sequencing of Mal d 1, the major allergen from apple (Malus domestica), and its immunological relationship to Bet v 1, the major birch pollen allergen."Vanek-Krebitz M., Hoffmann-Sommergruber K., Laimer da Camara Machado M., Susani M., Ebner C., Kraft D., Scheiner O., Breiteneder H.Biochem. Biophys. Res. Commun. 214:538-551(1995)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families: BetVI family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P43211

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose