null

Recombinant Horse Major allergen Equ c 1 | CSB-EP839158HO

(No reviews yet) Write a Review
SKU:
CSB-EP839158HO
Availability:
13 - 23 Working Days
  • Recombinant Horse Major allergen Equ c 1
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€352.00 - €1,702.00
Frequently bought together:

Description

Recombinant Horse Major allergen Equ c 1 | CSB-EP839158HO | Cusabio

Alternative Name(s): Allergen: Equ c 1

Gene Names: N/A

Research Areas: Others

Organism: Equus caballus (Horse)

AA Sequence: QQEENSDVAIRNFDISKISGEWYSIFLASDVKEKIEENGSMRVFVDVIRALDNSSLYAEYQTKVNGECTEFPMVFDKTEEDGVYSLNYDGYNVFRISEFENDEHIILYLVNFDKDRPFQLFEFYAREPDVSPEIKEEFVKIVQKRGIVKENIIDLTKIDRCFQLRGNGVAQA

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 16-187aa

Sequence Info: Full Length of Mature Protein

MW: 36.1 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance:

Reference: "cDNA cloning and sequencing reveal the major horse allergen Equ c1 to be a glycoprotein member of the lipocalin superfamily."Gregoire C., Rosinski-Chupin I., Rabillon J., Alzari P.M., David B., Dandeu J.-P.J. Biol. Chem. 271:32951-32959(1996)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location: Secreted

Protein Families: Calycin superfamily, Lipocalin family

Tissue Specificity: Expressed in liver and in sublingual and submaxillary salivary glands. Highly concentrated in secretory fluid such as saliva and urine as well as in hair dandruff extract.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q95182

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose