Cusabio Virus & Bacteria Recombinants
Recombinant Malus domestica Major allergen Mal d 1 (MALD1) | CSB-YP331771MPS
- SKU:
- CSB-YP331771MPS
- Availability:
- 3 - 7 Working Days
Description
Recombinant Malus domestica Major allergen Mal d 1 (MALD1) | CSB-YP331771MPS | Cusabio
Alternative Name(s): Allergen Mal d I Allergen: Mal d 1
Gene Names: MALD1
Research Areas: Allergen
Organism: Malus domestica (Apple) (Pyrus malus)
AA Sequence: GVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFGEGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHYHTKGNIEIKEEHVKVGKEKAHGLFKLIESYLKDHPDAYN
Source: Yeast
Tag Info: N-terminal 6xHis-tagged
Expression Region: 2-159aa
Sequence Info: Full Length of Mature Protein
MW: 19.5 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance:
Reference: "Cloning and sequencing of Mal d 1, the major allergen from apple (Malus domestica), and its immunological relationship to Bet v 1, the major birch pollen allergen."Vanek-Krebitz M., Hoffmann-Sommergruber K., Laimer da Camara Machado M., Susani M., Ebner C., Kraft D., Scheiner O., Breiteneder H.Biochem. Biophys. Res. Commun. 214:538-551(1995)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:
Involvement in disease:
Subcellular Location:
Protein Families: BetVI family
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P43211
HGNC Database Link: N/A
UniGene Database Link: N/A
KEGG Database Link: N/A
STRING Database Link: N/A
OMIM Database Link: N/A