Recombinant Macaca mulatta Uncharacterized protein (OSM) | CSB-YP2949MOWf3

(No reviews yet) Write a Review
SKU:
CSB-YP2949MOWf3
Availability:
25 - 35 Working Days
£306.40 - £1,076.00

Description

Recombinant Macaca mulatta Uncharacterized protein (OSM) | CSB-YP2949MOWf3 | Cusabio

Alternative Name(s): /

Gene Names: OSM

Research Areas: Immunology

Organism: Macaca mulatta (Rhesus macaque)

AA Sequence: MASMAAMGSCSKEYRMLLGQLQKQTDLMQDTSRLLDPYIRIQGLDIPKLREHCRESPGAFPSEETLRGLGRRGFLQTLNATLGRVLHRLADLEQHLPKAQDLERSGLNIEDLEKLQMARPNVLGLRNNVYCMAQLLDNSDMTEPTKAGRGTPQPPTPTPTSDVFQRKLEGCSFLRGYHRFMHSVGRVFSKWGESPNRSRRHSPHQALRKGVRRTRPSRKGNRLMPRGQLPR

Source: Yeast

Tag Info: C-terminal 6xHis-Myc-tagged

Expression Region: 1-231aa

Sequence Info: Full Length

MW: 27.1

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance:

Reference: "Evolutionary and biomedical insights from the rhesus macaque genome." Gibbs R.A., Rogers J., Katze M.G., Bumgarner R., Weinstock G.M., Mardis E.R., Remington K.A., Strausberg R.L., Venter J.C., Wilson R.K., Batzer M.A., Bustamante C.D., Eichler E.E., Hahn M.W., Hardison R.C., Makova K.D., Miller W., Milosavljevic A. Zwieg A.S. Science 316:222-234(2007)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: F7GF43

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose