Cusabio Macaca mulatta Recombinants
Recombinant Macaca mulatta Interleukin-10 (IL10) | CSB-BP011580MOW
- SKU:
- CSB-BP011580MOW
- Availability:
- 3 - 7 Working Days
Description
Recombinant Macaca mulatta Interleukin-10 (IL10) | CSB-BP011580MOW | Cusabio
Alternative Name(s): Cytokine synthesis inhibitory factor
Gene Names: IL10
Research Areas: Immunology
Organism: Macaca mulatta (Rhesus macaque)
AA Sequence: SPGQGTQSENSCTRFPGNLPHMLRDLRDAFSRVKTFFQMKDQLDNILLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENHDPDIKEHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFSKLQEKGVYKAMSEFDIFINYIEAYMTMKIQN
Source: Baculovirus
Tag Info: N-terminal 10xHis-tagged and C-terminal myc-tagged
Expression Region: 19-178aa
Sequence Info: Full Length of Mature Protein
MW: 22.7 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Inhibits the synthesis of a number of cytokines, including IFN-gamma, IL-2, IL-3, TNF and GM-CSF produced by activated macrophages and by helper T-cells.
Reference: "Comparative sequence analysis of cytokine genes from human and nonhuman primates." Villinger F.J., Brar S.S., Mayne A.E., Chikkala N., Ansari A.A. J. Immunol. 155:3946-3954(1995)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Inhibits the synthesis of a number of cytokines, including IFN-gamma, IL-2, IL-3, TNF and GM-CSF produced by activated macrophages and by helper T-cells.
Involvement in disease:
Subcellular Location: Secreted
Protein Families: IL-10 family
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P51496
HGNC Database Link: N/A
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: N/A