Recombinant Macaca mulatta Interleukin-15 (IL15) | CSB-YP011593MOW

Recombinant Macaca mulatta Interleukin-15 (IL15) | CSB-YP011593MOW | Cusabio

Alternative Name(s): IL15; Interleukin-15; IL-15

Gene Names: IL15

Research Areas: Others

Organism: Macaca mulatta (Rhesus macaque)

AA Sequence: NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISHESGDTDIHDTVENLIILANNILSSNGNITESGCKECEELEEKNIKEFLQSFVHIVQMFINTS

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 49-162aa

Sequence Info: Full Length of Mature Protein

MW: 14.9 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Cytokine that stimulates the proliferation of T-lymphocytes. Stimulation by IL-15 requires interaction of IL-15 with components of IL-2R, including IL-2R beta and probably IL-2R gamma but not IL-2R alpha.

Reference: "Comparative sequence analysis of cytokine genes from human and nonhuman primates."Villinger F.J., Brar S.S., Mayne A.E., Chikkala N., Ansari A.A.J. Immunol. 155:3946-3954(1995)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Cytokine that stimulates the proliferation of T-lymphocytes. Stimulation by IL-15 requires interaction of IL-15 with components of IL-2R, including IL-2R beta and probably IL-2R gamma but not IL-2R alpha.

Involvement in disease:

Subcellular Location: Secreted

Protein Families: IL-15/IL-21 family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P48092

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A