Recombinant Macaca fascicularis Erythropoietin (EPO) | CSB-MP007743MOV

(No reviews yet) Write a Review
SKU:
CSB-MP007743MOV
Availability:
3 - 7 Working Days
£340.00 - £808.00

Description

Recombinant Macaca fascicularis Erythropoietin (EPO) | CSB-MP007743MOV | Cusabio

Alternative Name(s): EPOErythropoietin

Gene Names: EPO

Research Areas: Cardiovascular

Organism: Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

AA Sequence: APPRLICDSRVLERYLLEAKEAENVTMGCSESCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQAVLANSSQPFEPLQLHMDKAISGLRSITTLLRALGAQEAISLPDAASAAPLRTITADTFCKLFRVYSNFLRGKLKLYTGEACRRGDR

Source: Mammalian cell

Tag Info: N-terminal 6xHis-tagged

Expression Region: 28-192aa

Sequence Info: Full Length of Mature Protein

MW: 22.2 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Hormone involved in the regulation of erythrocyte proliferation and differentiation and the maintenance of a physiological level of circulating erythrocyte mass. Binds to EPOR leading to EPOR dimerization and JAK2 activation thereby activating specific downstream effectors, including STAT1 and STAT3.

Reference: "Erythropoietin structure-function relationships: high degree of sequence homology among mammals." Wen D., Boissel J.-P.R., Tracy T.E., Gruninger R.H., Mulcahy L.S., Czelusniak J., Goodman M., Bunn H.F. Blood 82:1507-1516(1993)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P07865

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose