Cusabio Macaca fascicularis Recombinants
Recombinant Macaca fascicularis Alpha-synuclein (SNCA) | CSB-YP021912MOV
- SKU:
- CSB-YP021912MOV
- UPC:
- MPN:
- Availability:
- 3 - 7 Working Days
Description
Recombinant Macaca fascicularis Alpha-synuclein (SNCA) | CSB-YP021912MOV | Cusabio
Alternative Name(s): SNCA; Alpha-synuclein
Gene Names: SNCA
Research Areas: Others
Organism: Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
AA Sequence: MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFIKKDQLGKNEEGAPQEGILQDMPVDPDNEAYEMPSEEGYQDYEPEA
Source: Yeast
Tag Info: N-terminal 6xHis-tagged
Expression Region: 1-140aa
Sequence Info: Full Length
MW: 16.5 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: May be involved in the regulation of dopamine release and transport.
Reference: "Alpha-synuclein A53T substitution associated with Parkinson disease also marks the divergence of Old World and New World primates." Hamilton B.A.Genomics 83:739-742(2004)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: May be involved in the regulation of dopamine release and transport.
Involvement in disease:
Subcellular Location: Cytoplasm, cytosol, Membrane, Nucleus, Cell junction, synapse, Secreted
Protein Families: Synuclein family
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P61142
HGNC Database Link: N/A
UniGene Database Link: N/A
KEGG Database Link: KEGG
STRING Database Link: N/A
OMIM Database Link: N/A
Related Products

Recombinant Mouse Alpha-synuclein (Snca) | CSB-EP021912MO
Cusabio Mouse Recombinants

Recombinant Macaca fascicularis Alpha-synuclein (SNCA) | CSB-EP021912MOV
Cusabio Macaca fascicularis Recombinants

Recombinant Pig Alpha-synuclein (SNCA) | CSB-EP666915PI
Cusabio Sus scrofa Recombinants

Recombinant Pig Alpha-synuclein (SNCA) | CSB-EP666915PIa0
Cusabio Sus scrofa Recombinants

Recombinant Pig Alpha-synuclein (SNCA) | CSB-EP666915PIe1
Cusabio Sus scrofa Recombinants
Customers Also Viewed

Recombinant Macaca fascicularis Alpha-synuclein (SNCA) | CSB-EP021912MOV
Cusabio Macaca fascicularis Recombinants

Recombinant Mouse Alpha-synuclein (Snca) | CSB-EP021912MO
Cusabio Mouse Recombinants

Malachite Green ELISA Kit | CSB-EFD027642
Cusabio Food Safety & Drug Residues Kits

Phenylethanolamine A ELISA kit | CSB-EFD028239
Cusabio Food Safety & Drug Residues Kits

Stilbestrol ELISA kit | CSB-EFD028237
Cusabio Food Safety & Drug Residues Kits

Fluoroquinolones ELISA kit | CSB-E12036f
Cusabio Food Safety & Drug Residues Kits

Tetracyclines ELISA Kit | CSB-E12090f
Cusabio Food Safety & Drug Residues Kits

Mouse Pancreatic Lipase (PL) ELISA Kit | CSB-E16930m
Cusabio Elisa

Human alpha-amylase (AMY1) ELISA Kit | CSB-E14075h
Cusabio Elisa

Rat Pancreatic alpha-amylase (AMY2A) ELISA kit | CSB-EL001689RA
Cusabio Elisa

Human Regenerating Islet-derived 1 Alpha/pancreatic Stone Protein/pancreatic Thread Protein (REG1A) ELISA kit | CSB-E13324h
Cusabio Elisa

Human Pancreatic Amylase, PAMY ELISA Kit | CSB-E09691h
Cusabio Elisa

Melamine ELISA Kit | CSB-E12003f
Cusabio Elisa

Human OASL cDNA Clone BC117408 pENTR223.1 or pUC Plasmid
Cusabio Customized Plasmid

Human BAG3 cDNA Clone BC006418 pENTR223.1 or pUC Plasmid
Cusabio Customized Plasmid

Human BAG1 cDNA Clone BC001936 pENTR223.1 or pUC Plasmid
Cusabio Customized Plasmid

Human B4GALT7 cDNA Clone BC007317 pENTR223.1 or pUC Plasmid
Cusabio Customized Plasmid

Human B4GALT6 cDNA Clone BC069620 pENTR223.1 or pUC Plasmid
Cusabio Customized Plasmid

Human B3GALNT1 cDNA Clone BC047618 pENTR223.1 or pUC Plasmid
Cusabio Customized Plasmid

Recombinant Pig Alpha-synuclein (SNCA) | CSB-EP666915PIe1
Cusabio Sus scrofa Recombinants

Recombinant Pig Alpha-synuclein (SNCA) | CSB-EP666915PIa0
Cusabio Sus scrofa Recombinants

Recombinant Pig Alpha-synuclein (SNCA) | CSB-EP666915PI
Cusabio Sus scrofa Recombinants

Mouse pancreatic alpha amylase (AMY2A) ELISA kit
JopLink Cusabio