Recombinant Legionella pneumophila Outer membrane protein MIP (mip) | CSB-EP401660LLJ

Recombinant Legionella pneumophila Outer membrane protein MIP (mip) | CSB-EP401660LLJ | Cusabio

Alternative Name(s): Macrophage infectivity potentiator Peptidyl-prolyl cis-trans isomerase Short name: PPIase

Gene Names: mip

Research Areas: Immunology

Organism: Legionella pneumophila (strain Corby)

AA Sequence: ATDATSLATDKDKLSYSIGADLGKNFKNQGIDVNPEAMAKGMQDAMSGAQLALTEQQMKDVLNKFQKDLMAKRTAEFNKKADENKVKGEAFLTENKNKPGVVVLPSGLQYKVINAGNGVKPGKSDTVTVEYTGRLIDGTVFDSTEKTGKPATFQVSQVIPGWTEALQLMPAGSTWEIYVPSGLAYGPRSVGGPIGPNETLIFKIHLISVKKSS

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 21-233aa

Sequence Info: Full Length of Mature Protein

MW: 38.8 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Essential virulence factor associated with macrophage infectivity. Exhibits PPIase activity.

Reference: "Characterization of Mip proteins of Legionella pneumophila."Ludwig B., Rahfeld J., Schmidt B., Mann K., Wintermeyer E., Fischer G., Hacker J.FEMS Microbiol. Lett. 118:23-30(1994)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Essential virulence factor associated with macrophage infectivity. Exhibits PPIase activity.

Involvement in disease:

Subcellular Location: Cell outer membrane

Protein Families: FKBP-type PPIase family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: A5IGB8

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: KEGG

STRING Database Link: N/A

OMIM Database Link: N/A