Recombinant Klebsiella pneumoniae Beta-lactamase SHV-5 (bla) | CSB-EP358390KBG

(No reviews yet) Write a Review
SKU:
CSB-EP358390KBG
Availability:
3 - 7 Working Days
  • Recombinant Klebsiella pneumoniae Beta-lactamase SHV-5 (bla)
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP358390KBG could indicate that this peptide derived from E.coli-expressed Klebsiella pneumoniae bla.
€352.00 - €1,702.00

Description

Recombinant Klebsiella pneumoniae Beta-lactamase SHV-5 (bla) | CSB-EP358390KBG | Cusabio

Alternative Name(s): shv5

Gene Names: bla

Research Areas: Epigenetics and Nuclear Signaling

Organism: Klebsiella pneumoniae

AA Sequence: SPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRADERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGELCAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETELNEALPGDARDTTTPASMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGASKRGARGIVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR

Source: E.coli

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Expression Region: 22-286aa

Sequence Info: Full Length of Mature Protein

MW: 36.3 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: SHV enzymes hydrolyze broad spectrum cephalosporins notably cefotaxime and ceftazidime. SHV-5 causes particularly high levels of resistance to aztreonam and ceftazidime.

Reference: "Survey and molecular genetics of SHV beta-lactamases in Enterobacteriaceae in Switzerland: two novel enzymes, SHV-11 and SHV-12." Nuesch-Inderbinen M., Kayser F.H., Hachler H. Antimicrob. Agents Chemother. 41:943-949(1997)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: SHV enzymes hydrolyze broad spectrum cephalosporins notably cefotaxime and ceftazidime. SHV-5 causes particularly high levels of resistance to aztreonam and ceftazidime.

Involvement in disease:

Subcellular Location:

Protein Families: Class-A beta-lactamase family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P0A3M1

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: KEGG

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose