Recombinant Hypocrea jecorina Hydrophobin-1 (hfb1) | CSB-EP347143HYE

(No reviews yet) Write a Review
SKU:
CSB-EP347143HYE
Availability:
3 - 7 Working Days
  • Recombinant Hypocrea jecorina Hydrophobin-1 (hfb1)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$422.40 - $2,042.40

Description

Recombinant Hypocrea jecorina Hydrophobin-1 (hfb1) | CSB-EP347143HYE | Cusabio

Alternative Name(s): Hydrophobin I Short name:HFBI

Gene Names: hfb1

Research Areas: Microbiology

Organism: Hypocrea jecorina (Trichoderma reesei)

AA Sequence: SNGNGNVCPPGLFSNPQCCATQVLGLIGLDCKVPSQNVYDGTDFRNVCAKTGAQPLCCVAPVAGQALLCQTAVGA

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 23-97aa

Sequence Info: Full Length of Mature Protein

MW: 23.5 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Contributes to surface hydrophobicity, which is important for processes such as association of hyphae in reproductive structures, dispersal of aerial spores and adhesion of pathogens to host structures.

Reference: "Genetic and biochemical characterization of the Trichoderma reesei hydrophobin HFBI."Nakari-Setaelae T., Aro N., Kalkkinen N., Alatalo E., Penttilae M.Eur. J. Biochem. 235:248-255(1996)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Contributes to surface hydrophobicity, which is important for processes such as association of hyphae in reproductive structures, dispersal of aerial spores and adhesion of pathogens to host structures.

Involvement in disease:

Subcellular Location: Secreted, cell wall, Secreted

Protein Families: Cerato-ulmin hydrophobin family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P52754

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose