Cusabio Virus & Bacteria Recombinants
Recombinant Hypocrea jecorina Hydrophobin-1 (hfb1) | CSB-EP347143HYE
- SKU:
- CSB-EP347143HYE
- Availability:
- 3 - 7 Working Days
Description
Recombinant Hypocrea jecorina Hydrophobin-1 (hfb1) | CSB-EP347143HYE | Cusabio
Alternative Name(s): Hydrophobin I Short name:HFBI
Gene Names: hfb1
Research Areas: Microbiology
Organism: Hypocrea jecorina (Trichoderma reesei)
AA Sequence: SNGNGNVCPPGLFSNPQCCATQVLGLIGLDCKVPSQNVYDGTDFRNVCAKTGAQPLCCVAPVAGQALLCQTAVGA
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
Expression Region: 23-97aa
Sequence Info: Full Length of Mature Protein
MW: 23.5 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Contributes to surface hydrophobicity, which is important for processes such as association of hyphae in reproductive structures, dispersal of aerial spores and adhesion of pathogens to host structures.
Reference: "Genetic and biochemical characterization of the Trichoderma reesei hydrophobin HFBI."Nakari-Setaelae T., Aro N., Kalkkinen N., Alatalo E., Penttilae M.Eur. J. Biochem. 235:248-255(1996)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Contributes to surface hydrophobicity, which is important for processes such as association of hyphae in reproductive structures, dispersal of aerial spores and adhesion of pathogens to host structures.
Involvement in disease:
Subcellular Location: Secreted, cell wall, Secreted
Protein Families: Cerato-ulmin hydrophobin family
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P52754
HGNC Database Link: N/A
UniGene Database Link: N/A
KEGG Database Link: N/A
STRING Database Link: N/A
OMIM Database Link: N/A