Recombinant Human WNT1-inducible-signaling pathway protein 2 (WISP2) | CSB-EP026120HU(A4)

Recombinant Human WNT1-inducible-signaling pathway protein 2 (WISP2) | CSB-EP026120HU(A4) | Cusabio

Alternative Name(s): CCN family member 5 Connective tissue growth factor-like protein

Gene Names: WISP2

Research Areas: Stem Cells

Organism: Homo sapiens (Human)

AA Sequence: MRGTPKTHLLAFSLLCLLSKVRTQLCPTPCTCPWPPPRCPLGVPLVLDGCGCCRVCARRLGEPCDQLHVCDASQGLVCQPGAGPGGRGALCLLAEDDSSCEVNGRLYREGETFQPHCSIRCRCEDGGFTCVPLCSEDVRLPSWDCPHPRRVEVLGKCCPEWVCGQGGGLGTQPLPAQGPQFSGLVSSLPPGVPCPEWSTAWGPCSTTCGLGMATRVSNQNRFCRLETQRRLCLSRPCPPSRGRSPQNSAF

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 1-250aa

Sequence Info: Full Length

MW: 51.3 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: May play an important role in modulating bone turnover. Promotes the adhesion of osteoblast cells and inhibits the binding of fibrinogen to integrin receptors. In addition, inhibits osteocalcin production.

Reference: "CT58, a new member of the connective tissue growth factor family, interacts with the breast cancer associated mucin MUC1." Rowles J., Gendler S. Submitted (JUN-1998)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: May play an important role in modulating bone turnover. Promotes the adhesion of osteoblast cells and inhibits the binding of fibrinogen to integrin receptors. In addition, inhibits osteocalcin production.

Involvement in disease:

Subcellular Location: Secreted

Protein Families: CCN family

Tissue Specificity: Expressed in primary osteoblasts, fibroblasts, ovary, testes, and heart.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: O76076

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM