Cusabio Active Proteins
Recombinant Human UL16-binding protein 1 (ULBP1), Biotinylated (Active) | CSB-MP887177HUj1-B
- SKU:
- CSB-MP887177HUj1-B
- Availability:
- 3 to 7 Working Days
Description
Recombinant Human UL16-binding protein 1 (ULBP1) ,Biotinylated (Active) | CSB-MP887177HUj1-B | Cusabio
Protein Description: Full Length of Mature Protein
Alternative Name (s) :
Gene Names: ULBP1
Research Areas: Cancer
Species: Homo sapiens (Human)
Source: Mammalian cell
Tag Info: C-terminal mFc-Avi-tagged
Expression Region: 26-216aa
Sequence Info: GWVDTHCLCYDFIITPKSRPEPQWCEVQGLVDERPFLHYDCVNHKAKAFASLGKKVNVTKTWEEQTETLRDVVDFLKGQLLDIQVENLIPIEPLTLQARMSCEHEAHGHGRGSWQFLFNGQKFLLFDSNNRKWTALHPGAKKMTEKWEKNRDVTMFFQKISLGDCKMWLEEFLMYWEQMLDPTKPPSLAPG
Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized KLRK1 (CSB-MP012474HU1) at 10 μg/ml can bind human Biotinylated ULBP1, the EC50 is 4.254-7.295 ng/ml.
MW: 51.3
Purity: Greater than 95% as determined by SDS-PAGE.
Endotoxin: Less than 1.0 EU/ug as determined by LAL method.
Relevance:
PubMed ID:
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Function:
Involvement in disease:
Subcellular Location:
Protein Families:
Tissue Specificity:
Paythway:
Form: Lyophilized powder
Buffer: Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: Q9BZM6
Uniprot Entry Name:
HGNC Database Link: N/A
UniGene Database Link: N/A
KEGG Database Link: N/A
STRING Database Link: N/A
OMIM Database Link: N/A