null

Recombinant Human Retinol-binding protein 4 (RBP4) (Active) | CSB-MP019483HU

(No reviews yet) Write a Review
SKU:
CSB-MP019483HU
Availability:
3 to 7 Working Days
  • Recombinant Human Retinol-binding protein 4 (RBP4) (Active)
  • Recombinant Human Retinol-binding protein 4 (RBP4) (Active) Activity
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€209.00 - €339.00
Frequently bought together:

Description

Recombinant Human Retinol-binding protein 4 (RBP4) (Active) | CSB-MP019483HU | Cusabio

Protein Description: Full Length of Mature Protein

Alternative Name (s) : (Plasma retinol-binding protein) (PRBP) (RBP)

Gene Names: RBP4

Research Areas: Cancer

Species: Homo sapiens (Human)

Source: Mammalian cell

Tag Info: C-terminal hFc-tagged

Expression Region: 19-201aa

Sequence Info: ERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLARQYRLIVHNGYCDGRSERNLL

Biological Activity: ①Measured by its binding ability in a functional ELISA. Immobilized RBP4 at 5 μg/ml can bind TTR (CSB-MP025270HUh6) , the EC50 is 695.0-970.1 ng/ml.

MW: 50 kDa

Purity: Greater than 94% as determined by SDS-PAGE.

Endotoxin: Less than 1.0 EU/ug as determined by LAL method.

Relevance: Retinol-binding protein that mediates retinol transport in blood plasma (PubMed:5541771) . Delivers retinol from the liver stores to the peripheral tissues (Probable) . Transfers the bound all-trans retinol to STRA6, that then facilitates retinol transport across the cell membrane (PubMed:22665496)

PubMed ID:

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Lyophilized powder

Buffer: Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P02753

Uniprot Entry Name:

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose