Recombinant Human UL16-binding protein 1 (ULBP1) (Active) | CSB-MP887177HU

Recombinant Human UL16-binding protein 1 (ULBP1) (Active) | CSB-MP887177HU | Cusabio

Protein Description: Full Length of Mature Protein

Alternative Name (s) : (ALCAN-beta) (NKG2D ligand 1) (N2DL-1) (NKG2DL1) (Retinoic acid early transcript 1I)

Gene Names: ULBP1

Research Areas: Cancer

Species: Homo sapiens (Human)

Source: Mammalian cell

Tag Info: C-terminal hFc-Myc-tagged

Expression Region: 26-216aa

Sequence Info: GWVDTHCLCYDFIITPKSRPEPQWCEVQGLVDERPFLHYDCVNHKAKAFASLGKKVNVTKTWEEQTETLRDVVDFLKGQLLDIQVENLIPIEPLTLQARMSCEHEAHGHGRGSWQFLFNGQKFLLFDSNNRKWTALHPGAKKMTEKWEKNRDVTMFFQKISLGDCKMWLEEFLMYWEQMLDPTKPPSLAPG

Biological Activity: ①Measured by its binding ability in a functional ELISA. Immobilized KLRK1 (CSB-MP012474HU1) at 10 μg/ml can bind human ULBP1, the EC50 of human ULBP1 protein is 228.5-427.6 ng/ml. ②Human KLRK1 protein Fc tag (CSB-MP012474HU1) captured on COOH chip can bind Human ULBP1 protein Fc/myc tag (CSB-MP887177HU) with an affinity constant of 2.27 nM as detected by LSPR Assay.

MW: 52.4 kDa

Purity: Greater than 93% as determined by SDS-PAGE.

Endotoxin: Less than 1.0 EU/ug as determined by LAL method.

Relevance: Binds and activates the KLRK1/NKG2D receptor, mediating natural killer cell cytotoxicity.

PubMed ID:

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Lyophilized powder

Buffer: Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q9BZM6

Uniprot Entry Name:

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A