Recombinant Human Tumor necrosis factor receptor superfamily member 9 (TNFRSF9), partial (Active) | CSB-AP005131HU

Recombinant Human Tumor necrosis factor receptor superfamily member 9 (TNFRSF9) ,partial (Active) | CSB-AP005131HU | Cusabio

Protein Description: Extracellular Domain

Alternative Name (s) : CD137;ILA;TNFRSF9;4-1BB ligand receptor;CDw137;T-cell antigen 4-1BB homolog;T-cell antigen ILA

Gene Names: TNFRSF9

Research Areas: Cancer

Species: Homo sapiens (Human)

Source: Mammalian cell

Tag Info: C-terminal 6xHis-Fc-tagged

Expression Region: 24-186aa

Sequence Info: LQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQCKGVFRTRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPAREPGHSPQ

Biological Activity: The ED50 as determined by its ability to bind Human TNFSF9 in functional ELISA is less than 50 ug/ml.

MW: 44 kDa

Purity: Greater than 95% as determined by SDS-PAGE.

Endotoxin: Less than 1.0 EU/µg as determined by LAL method.

Relevance: Tumor necrosis factor receptor superfamily member 9 (TNFRSF9) is an inducible T cell surface protein belonging to the TNF receptor superfamily. It is a single-pass type I membrane protein which contains 4 TNFR-Cys repeats. The human and mouse proteins share 60% amino acid sequence identity. It is absent from naive T cells, but upregulated and continually expressed following T cell activation. It is a receptor for TNFSF9/4-1BBL, and possibly active during T cell activation.

PubMed ID:

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Function: Receptor for TNFSF9/4-1BBL. Possibly active during T cell activation.

Involvement in disease:

Subcellular Location: Membrane, Single-pass type I membrane protein

Protein Families:

Tissue Specificity: Expressed on the surface of activated T-cells.

Paythway:

Form: Lyophilized powder

Buffer: Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q07011

Uniprot Entry Name:

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM