- Home
- Research Recombinants
- Recombinant Human Tumor necrosis factor receptor superfamily member 9 (TNFRSF9), partial (Active) | CSB-MP023984HU1
Cusabio Active Proteins
Recombinant Human Tumor necrosis factor receptor superfamily member 9 (TNFRSF9), partial (Active) | CSB-MP023984HU1
- SKU:
- CSB-MP023984HU1
- UPC:
- MPN:
- Availability:
- 3 to 7 Working Days
Description
Recombinant Human Tumor necrosis factor receptor superfamily member 9 (TNFRSF9) ,partial (Active) | CSB-MP023984HU1 | Cusabio
Protein Description: Partial
Alternative Name (s) : (4-1BB ligand receptor) (CDw137) (T-cell antigen 4-1BB homolog) (T-cell antigen ILA) (CD antigen CD137)
Gene Names: TNFRSF9
Research Areas: Cancer
Species: Homo sapiens (Human)
Source: Mammalian cell
Tag Info: C-terminal 10xHis-tagged
Expression Region: 24-186aa
Sequence Info: LQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQCKGVFRTRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPAREPGHSPQ
Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized TNFRSF9 at 2 μg/mL can bind TNFSF9(CSB-MP023997HU1), the EC50 is 1.011-2.429 ng/mL.
MW: 19.1 kDa
Purity: Greater than 95% as determined by SDS-PAGE.
Endotoxin: Less than 1.0 EU/ug as determined by LAL method.
Relevance: Receptor for TNFSF9/4-1BBL. Possibly active during T cell activation.
PubMed ID:
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Function:
Involvement in disease:
Subcellular Location:
Protein Families:
Tissue Specificity:
Paythway:
Form: Lyophilized powder
Buffer: Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: Q07011
Uniprot Entry Name:
HGNC Database Link: N/A
UniGene Database Link: N/A
KEGG Database Link: N/A
STRING Database Link: N/A
OMIM Database Link: N/A
Related Products

Recombinant Human Tumor necrosis factor receptor superfamily member 9 protein (TNFRSF9) (Active) | CSB-AP001951HU
Cusabio Active Proteins

Recombinant Human Tumor necrosis factor receptor superfamily member 9 (TNFRSF9), partial (Active) | CSB-AP005131HU
Cusabio Active Proteins

Recombinant Human Tumor necrosis factor receptor superfamily member 9 (TNFRSF9), partial (Active) | CSB-AP005141HU
Cusabio Active Proteins

Recombinant Human Tumor necrosis factor receptor superfamily member 9 (TNFRSF9), partial (Active) | CSB-AP005151HU
Cusabio Active Proteins

Recombinant Human Tumor necrosis factor receptor superfamily member 4 (TNFRSF4), partial (Active) | CSB-AP005251HU
Cusabio Active Proteins
Customers Also Viewed

Recombinant Human Tumor necrosis factor receptor superfamily member 4 (TNFRSF4), partial (Active) | CSB-AP005251HU
Cusabio Active Proteins

Recombinant Human Tumor necrosis factor receptor superfamily member 9 (TNFRSF9), partial (Active) | CSB-AP005151HU
Cusabio Active Proteins

Recombinant Human Tumor necrosis factor receptor superfamily member 9 (TNFRSF9), partial (Active) | CSB-AP005141HU
Cusabio Active Proteins

Recombinant Human Tumor necrosis factor receptor superfamily member 9 (TNFRSF9), partial (Active) | CSB-AP005131HU
Cusabio Active Proteins

Recombinant Human Tumor necrosis factor receptor superfamily member 9 protein (TNFRSF9) (Active) | CSB-AP001951HU
Cusabio Active Proteins

Human POTE ankyrin domain family member E (POTEE) ELISA kit | CSB-EL740863HU
Cusabio Elisa

Human transient receptor potential cation channel subfamily V member 1 (TrpV1) ELISA Kit | CSB-E14198h
Cusabio Elisa

Human C-type lectin domain family 7 member A (CLEC7A) ELISA kit | CSB-EL005541HU
Cusabio Elisa

Human C-type lectin domain family 2 member D (CLEC2D) ELISA kit | CSB-EL005528HU
Cusabio Elisa

Human C-type lectin domain family 9 member A (CLEC9A) ELISA kit | CSB-EL005542HU
Cusabio Elisa

Human C-type lectin domain family 18 member A (CLEC18A) ELISA kit | CSB-EL005521HU
Cusabio Elisa

Recombinant Human Tumor necrosis factor receptor superfamily member 8 (TNFRSF8), partial (Active) | CSB-MP023983HU1
Cusabio Active Proteins

Recombinant Human IGFL1 (Active)
Cusabio Active Proteins

Recombinant Human Tumor necrosis factor ligand superfamily member 9 (TNFSF9), partial (Active) | CSB-MP023997HU1
Cusabio Active Proteins

Recombinant Human Tumor necrosis factor ligand superfamily member 13B (TNFSF13B), partial, Biotinylated (Active) | CSB-MP897523HU1-B
Cusabio Active Proteins

Recombinant Human Tumor necrosis factor ligand superfamily member 8 (TNFSF8), partial (Active) | CSB-MP023996HU1c9
Cusabio Active Proteins

Recombinant Human Tumor necrosis factor ligand superfamily member 8 (TNFSF8), partial (Active) | CSB-MP023996HU1
Cusabio Active Proteins

Recombinant Human Tumor necrosis factor ligand superfamily member 14 (TNFSF14), partial, Biotinylated (Active) | CSB-MP023991HUj7-B
Cusabio Active Proteins

Recombinant Human Tumor necrosis factor receptor superfamily member 1A (TNFRSF1A), partial (Active) | CSB-MP023977HU1
Cusabio Active Proteins

Recombinant Human Tumor necrosis factor receptor superfamily member 11B (TNFRSF11B) (Active) | CSB-MP023969HU
Cusabio Active Proteins

Recombinant Human Tumor necrosis factor receptor superfamily member 13C (TNFRSF13C), partial (Active) | CSB-MP853495HU1
Cusabio Active Proteins

Recombinant Human Tumor necrosis factor receptor superfamily member 5 (CD40), partial (Active) | CSB-MP004936HU1
Cusabio Active Proteins

Recombinant Human Tumor necrosis factor ligand superfamily member 18 (TNFSF18), partial (Active) | CSB-MP891791HU
Cusabio Active Proteins

Recombinant Human Tumor necrosis factor receptor superfamily member 18 (TNFRSF18), partial (Active) | CSB-MP896537HU
Cusabio Active Proteins

Recombinant Human Tumor necrosis factor ligand superfamily member 14 (TNFSF14), partial (Active) | CSB-MP023991HUj2
Cusabio Active Proteins

Recombinant Human Tumor necrosis factor receptor superfamily member 14 (TNFRSF14), partial (Active) | CSB-MP842173HU
Cusabio Active Proteins

Recombinant Human Tumor necrosis factor receptor superfamily member 1B (TNFRSF1B), partial (Active) | CSB-MP023978HU2
Cusabio Active Proteins

Recombinant Human Tumor necrosis factor ligand superfamily member 13B (TNFSF13B), partial (Active) | CSB-MP897523HU1
Cusabio Active Proteins

Recombinant Human Tumor necrosis factor receptor superfamily member 17 (TNFRSF17), partial (Active) | CSB-MP023974HU1
Cusabio Active Proteins