Recombinant Human Tumor necrosis factor receptor superfamily member 4 (TNFRSF4), partial (Active) | CSB-AP005251HU

Recombinant Human Tumor necrosis factor receptor superfamily member 4 (TNFRSF4) ,partial (Active) | CSB-AP005251HU | Cusabio

Protein Description: Partial

Alternative Name (s) : Tumor necrosis factor receptor superfamily member 4;ACT35 antigen;OX40L receptor;TAX transcriptionally-activated glycoprotein 1 receptor;TNFRSF4;OX40;CD134;Txgp1

Gene Names: TNFRSF4

Research Areas: Cancer

Species: Homo sapiens (Human)

Source: Mammalian cell

Tag Info: C-terminal Fc-tagged

Expression Region: 29-216aa

Sequence Info: LHCVGDTYPSNDRCCHECRPGNGMVSRCSRSQNTVCRPCGPGFYNDVVSSKPCKPCTWCNLRSGSERKQLCTATQDTVCRCRAGTQPLDSYKPGVDCAPCPPGHFSPGDNQACKPWTNCTLAGKHTLQPASNSSDAICEDRDPPATQPQETQGPPARPITVQPTEAWPRTSQGPSTRPVEVPGGRAVA

Biological Activity: The ED50 as determined by its ability to bind Human TNFSF4 in functional ELISA is less than 10 ug/ml.

MW: 46.8 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Endotoxin: Less than 1.0 EU/µg as determined by LAL method.

Relevance: OX40,also termed CD134 and TNFRSF4, is a T cell co-stimulatory molecule of the TNF receptor superfamily which plays a key role in the survival and homeostasis of effector and memory T cells. OX40 is expressed on CD4+ and CD8+ T cells upon engagement of the TCR by antigen presenting cells along with co-stimulation by CD40-CD40 Ligand and CD28-B7. The interaction between OX40 and OX40 ligand (OX40L) will occur when activated T cells bind to professional antigen-presenting cells (APCs) . The T-cell functions, including cytokine production, expansion, and survival, are then enhanced by the OX40 costimulatory signals. OX40 signals are critical for controlling the function and differentiation of Foxp3+ regulatory T cells. OX40-OX40L interaction regulates T-cell tolerance, peripheral T-cell homeostasis, and T-cell-mediated inflammatory diseases.

PubMed ID:

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Function: Receptor for TNFSF4/OX40L/GP34. Is a costimulatory molecule implicated in long-term T-cell immunity.

Involvement in disease: Immunodeficiency 16 (IMD16)

Subcellular Location: Membrane, Single-pass type I membrane protein

Protein Families:

Tissue Specificity:

Paythway:

Form: Lyophilized powder

Buffer: Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P43489

Uniprot Entry Name:

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM