Recombinant Human Tumor necrosis factor receptor superfamily member 1A (TNFRSF1A), partial (Active) | CSB-AP004971HU

(No reviews yet) Write a Review
SKU:
CSB-AP004971HU
Availability:
5 to 10 Working Days
  • Recombinant Human Tumor necrosis factor receptor superfamily member 1A (TNFRSF1A) ,partial (Active)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$278.40 - $595.20

Description

Recombinant Human Tumor necrosis factor receptor superfamily member 1A (TNFRSF1A) ,partial (Active) | CSB-AP004971HU | Cusabio

Protein Description: Partial

Alternative Name (s) : Tumor necrosis factor receptor superfamily member 1A;Tumor necrosis factor receptor 1;TNF-R1;Tumor necrosis factor receptor type I;TNF-RI;TNFR-I;TNFAR; TNFR1

Gene Names: TNFRSF1A

Research Areas: Cancer

Species: Homo sapiens (Human)

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 22-211aa

Sequence Info: IYPSGVIGLVPHLGDREKRDSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIENVKGTEDSGTT

Biological Activity: The ED50 as determined by its ability to inhibit the TNF-alpha mediated cytotoxicity in the L‑929 mouse fibroblast cells is less than 500 ng/ml in the presence of the metabolic inhibitor actinomycin D.

MW: 23.5 kDa

Purity: Greater than 95% as determined by SDS-PAGE.

Endotoxin: Less than 1.0 EU/µg as determined by LAL method.

Relevance: Tumor necrosis factor receptor superfamily member 1A (Tnfrsf1a) is a member of the tumor necrosis factor receptor superfamily. Tnfrsf1a is one of the major receptors for the tumor necrosis factor-alpha. It can activate the transcription factor NF-κB, mediate apoptosis, and function as a regulator of inflammation. Antiapoptotic protein BCL2-associated athanogene 4 (BAG4/SODD) and adaptor proteins TRADD and TRAF2 have been shown to interact with this receptor, and thus play regulatory roles in the signal transduction mediated by the receptor. Germline mutations of the extracellular domains of this receptor were found to be associated with the human genetic disorder called tumor necrosis factor associated periodic syndrome (TRAPS) or periodic fever syndrome

PubMed ID:

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Function: Receptor for TNFSF2/TNF-alpha and homotrimeric TNFSF1/lymphotoxin-alpha. The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation which initiates the subsequent cascade of caspases (aspartate-specific cysteine proteases) mediating apoptosis. Contributes to the induction of non-cytocidal TNF effects including anti-viral state and activation of the acid sphingomyelinase.

Involvement in disease: Familial hibernian fever (FHF) ; Multiple sclerosis 5 (MS5)

Subcellular Location: Cell membrane, Single-pass type I membrane protein, Golgi apparatus membrane, Single-pass type I membrane protein, Secreted, Note=A secreted form is produced through proteolytic processing, SUBCELLULAR LOCATION: Isoform 4: Secreted

Protein Families:

Tissue Specificity:

Paythway: MAPKsignalingpathway

Form: Lyophilized powder

Buffer: Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P19438

Uniprot Entry Name:

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose