Recombinant Human Tumor necrosis factor receptor superfamily member 1A (TNFRSF1A), partial (Active) | CSB-MP023977HU1

Recombinant Human Tumor necrosis factor receptor superfamily member 1A (TNFRSF1A) ,partial (Active) | CSB-MP023977HU1 | Cusabio

Protein Description: Partial

Alternative Name (s) :

Gene Names: TNFRSF1A

Research Areas: Signal Transduction

Species: Homo sapiens (Human)

Source: Mammalian cell

Tag Info: C-terminal hFc-tagged

Expression Region: 22-211aa

Sequence Info: IYPSGVIGLVPHLGDREKRDSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIENVKGTEDSGTT

Biological Activity: ①Measured by its binding ability in a functional ELISA. Immobilized TNF-α (CSB-YP023955HU) at 5 μg/ml can bind human TNFR1, the EC50 is 7.799-10.90 ng/ml.②Measured by its binding ability in a functional ELISA. Immobilized LTA (CSB-MP013218HU) at 5 μg/ml can bind human TNFR1, the EC50 is 4.409-6.797 ng/ml.

MW: 50.1

Purity: Greater than 94% as determined by SDS-PAGE.

Endotoxin: Less than 1.0 EU/ug as determined by LAL method.

Relevance:

PubMed ID:

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Lyophilized powder

Buffer: Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P19438

Uniprot Entry Name:

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A