Recombinant Human Triggering receptor expressed on myeloid cells 2 (TREM2), partial | CSB-EP024405HU

(No reviews yet) Write a Review
SKU:
CSB-EP024405HU
Availability:
3 - 7 Working Days
  • Recombinant Human Triggering receptor expressed on myeloid cells 2 (TREM2), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$294.00 - $1,532.40

Description

Recombinant Human Triggering receptor expressed on myeloid cells 2 (TREM2), partial | CSB-EP024405HU | Cusabio

Alternative Name(s): Triggering receptor expressed on monocytes 2

Gene Names: TREM2

Research Areas: Immunology

Organism: Homo sapiens (Human)

AA Sequence: HNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVLADPLDHRDAGDLWFPGESESFEDAHVEHSISRSLLEGEIPFPPTS

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 19-174aa

Sequence Info: Extracellular Domain

MW: 21.4 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: May have a role in chronic inflammations and may stimulate production of constitutive rather than inflammatory chemokines and cytokines. Forms a receptor signaling complex with TYROBP and triggers activation of the immune responses in macrophages and dendritic cells.

Reference: "Inflammatory responses can be triggered by TREM-1, a novel receptor expressed on neutrophils and monocytes."Bouchon A., Dietrich J., Colonna M.J. Immunol. 164:4991-4995(2000)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Forms a receptor signaling complex with TYROBP and triggers activation of the immune responses in macrophages and dendritic cells. May have a role in chronic inflammations and may stimulate production of constitutive rather than inflammatory chemokines and cytokines.

Involvement in disease: Polycystic lipomembranous osteodysplasia with sclerosing leukoencephalopathy (PLOSL)

Subcellular Location: Isoform 1: Cell membrane, Single-pass type I membrane protein, SUBCELLULAR LOCATION: Isoform 2: Secreted, SUBCELLULAR LOCATION: Isoform 3: Secreted

Protein Families:

Tissue Specificity: Expressed on macrophages and dendritic cells but not on granulocytes or monocytes. In the CNS strongest expression seen in the basal ganglia, corpus callosum, medulla oblongata and spinal cord.

Paythway: Osteoclastdifferentiation

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q9NZC2

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose