Recombinant Human Trefoil factor 3 (TFF3), partial | CSB-EP023433HU

(No reviews yet) Write a Review
SKU:
CSB-EP023433HU
Availability:
3 - 7 Working Days
$319.20 - $1,728.00

Description

Recombinant Human Trefoil factor 3 (TFF3), partial | CSB-EP023433HU | Cusabio

Alternative Name(s): Intestinal trefoil factor (hITF) (Polypeptide P1.B) (hP1.B) (ITF) (TFI)

Gene Names: TFF3

Research Areas: Signal Transduction

Organism: Homo sapiens (Human)

AA Sequence: ANQCAVPAKDRVDCGYPHVTPKECNNRGCCFDSRIPGVPWCFKPLQEAECTF

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 29-80aa

Sequence Info: Partial

MW: 33.2 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Involved in the maintenance and repair of the intestinal mucosa. Promotes the mobility of epithelial cells in healing processes.

Reference: "mRNA 5' region sequence incompleteness: a potential source of systematic errors in translation initiation codon assignment in human mRNAs." Casadei R., Strippoli P., D'Addabbo P., Canaider S., Lenzi L., Vitale L., Giannone S., Frabetti F., Facchin F., Carinci P., Zannotti M. Gene 321:185-193(2003)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q07654

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose