Cusabio Human Recombinants
Recombinant Human Trefoil factor 3 (TFF3), partial | CSB-EP023433HU
- SKU:
- CSB-EP023433HU
- Availability:
- 3 - 7 Working Days
Description
Recombinant Human Trefoil factor 3 (TFF3), partial | CSB-EP023433HU | Cusabio
Alternative Name(s): Intestinal trefoil factor (hITF) (Polypeptide P1.B) (hP1.B) (ITF) (TFI)
Gene Names: TFF3
Research Areas: Signal Transduction
Organism: Homo sapiens (Human)
AA Sequence: ANQCAVPAKDRVDCGYPHVTPKECNNRGCCFDSRIPGVPWCFKPLQEAECTF
Source: E.coli
Tag Info: N-terminal GST-tagged
Expression Region: 29-80aa
Sequence Info: Partial
MW: 33.2 kDa
Purity: Greater than 85% as determined by SDS-PAGE.
Relevance: Involved in the maintenance and repair of the intestinal mucosa. Promotes the mobility of epithelial cells in healing processes.
Reference: "mRNA 5' region sequence incompleteness: a potential source of systematic errors in translation initiation codon assignment in human mRNAs." Casadei R., Strippoli P., D'Addabbo P., Canaider S., Lenzi L., Vitale L., Giannone S., Frabetti F., Facchin F., Carinci P., Zannotti M. Gene 321:185-193(2003)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:
Involvement in disease:
Subcellular Location:
Protein Families:
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: Q07654
HGNC Database Link: N/A
UniGene Database Link: N/A
KEGG Database Link: N/A
STRING Database Link: N/A
OMIM Database Link: N/A