Recombinant Human Thioredoxin, mitochondrial (TXN2) | CSB-EP857458HU

Recombinant Human Thioredoxin, mitochondrial (TXN2) | CSB-EP857458HU | Cusabio

Alternative Name(s): Thioredoxin-2

Gene Names: TXN2

Research Areas: Signal Transduction

Organism: Homo sapiens (Human)

AA Sequence: TTFNIQDGPDFQDRVVNSETPVVVDFHAQWCGPCKILGPRLEKMVAKQHGKVVMAKVDIDDHTDLAIEYEVSAVPTVLAMKNGDVVDKFVGIKDEDQLEAFLKKLIG

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 1-166aa

Sequence Info: Full Length

MW: 38.9 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Important for the control of mitochondrial reactive oxygen species homeostasis, apoptosis regulation and cell viability. Possesses a dithiol-reducing activity.

Reference: "Overexpressed human mitochondrial thioredoxin confers resistance to oxidant-induced apoptosis in human osteosarcoma cells." Chen Y., Cai J., Murphy T.J., Jones D.P. J. Biol. Chem. 277:33242-33248(2002)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Important for the control of mitochondrial reactive oxygen species homeostasis, apoptosis regulation and cell viability. Possesses a dithiol-reducing activity.

Involvement in disease: Combined oxidative phosphorylation deficiency 29 (COXPD29)

Subcellular Location: Mitochondrion

Protein Families: Thioredoxin family

Tissue Specificity: Widely expressed in adult (at protein level) and fetal tissues.

Paythway: NOD-likereceptorsignalingpathway

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q99757

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM