Cusabio Human Recombinants
Recombinant Human TGFB1-induced anti-apoptotic factor 1 (TIAF1) | CSB-EP023528HU
- SKU:
- CSB-EP023528HU
- Availability:
- 13 - 23 Working Days
Description
Recombinant Human TGFB1-induced anti-apoptotic factor 1 (TIAF1) | CSB-EP023528HU | Cusabio
Alternative Name(s): 12KDA TGF-beta-1-induced antiapoptotic factor
Gene Names: TIAF1
Research Areas: Cell Biology
Organism: Homo sapiens (Human)
AA Sequence: MSSPSSPFREQSFLCAAGDAGEESRVQVLKNEVRRGSPVLLGWVEQAYADKCVCGPSAPPAPTPPSLSQRVMCNDLFKVNPFQLQQFRADPSTASLLLCPGGLDHKLNLRGKAWG
Source: E.coli
Tag Info: N-terminal GST-tagged
Expression Region: 1-115aa
Sequence Info: Full Length
MW: 39.4 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Inhibits the cytotoxic effects of TNF-alpha and overexpressed TNF receptor adapters TRADD, FADD, and RIPK1. Involved in TGF-beta1 inhibition of IkappaB-alpha expression and suppression of TNF-mediated IkappaB-alpha degradation.
Reference: "High expression of TIAF-1 in chronic kidney and liver allograft rejection and in activated T-helper cells." van der Leij J., van den Berg A., Albrecht E.W., Blokzijl T., Roozendaal R., Gouw A.S., de Jong K.P., Stegeman C.A., van Goor H., Chang N.S., Poppema S. Transplantation 75:2076-2082(2003)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Inhibits the cytotoxic effects of TNF-alpha and overexpressed TNF receptor adapters TRADD, FADD, and RIPK1. Involved in TGF-beta1 inhibition of IkappaB-alpha expression and suppression of TNF-mediated IkappaB-alpha degradation.
Involvement in disease:
Subcellular Location: Nucleus
Protein Families:
Tissue Specificity: Not detectable in normal kidney and liver. Up-regulated in chronic and acute allograft rejection: expressed in the inflammatory infiltrate and in tubular epithelial cells.
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: O95411
HGNC Database Link: HGNC
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: OMIM