Recombinant Human TGFB1-induced anti-apoptotic factor 1 (TIAF1) | CSB-EP023528HU

Recombinant Human TGFB1-induced anti-apoptotic factor 1 (TIAF1) | CSB-EP023528HU | Cusabio

Alternative Name(s): 12KDA TGF-beta-1-induced antiapoptotic factor

Gene Names: TIAF1

Research Areas: Cell Biology

Organism: Homo sapiens (Human)

AA Sequence: MSSPSSPFREQSFLCAAGDAGEESRVQVLKNEVRRGSPVLLGWVEQAYADKCVCGPSAPPAPTPPSLSQRVMCNDLFKVNPFQLQQFRADPSTASLLLCPGGLDHKLNLRGKAWG

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 1-115aa

Sequence Info: Full Length

MW: 39.4 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Inhibits the cytotoxic effects of TNF-alpha and overexpressed TNF receptor adapters TRADD, FADD, and RIPK1. Involved in TGF-beta1 inhibition of IkappaB-alpha expression and suppression of TNF-mediated IkappaB-alpha degradation.

Reference: "High expression of TIAF-1 in chronic kidney and liver allograft rejection and in activated T-helper cells." van der Leij J., van den Berg A., Albrecht E.W., Blokzijl T., Roozendaal R., Gouw A.S., de Jong K.P., Stegeman C.A., van Goor H., Chang N.S., Poppema S. Transplantation 75:2076-2082(2003)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Inhibits the cytotoxic effects of TNF-alpha and overexpressed TNF receptor adapters TRADD, FADD, and RIPK1. Involved in TGF-beta1 inhibition of IkappaB-alpha expression and suppression of TNF-mediated IkappaB-alpha degradation.

Involvement in disease:

Subcellular Location: Nucleus

Protein Families:

Tissue Specificity: Not detectable in normal kidney and liver. Up-regulated in chronic and acute allograft rejection: expressed in the inflammatory infiltrate and in tubular epithelial cells.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: O95411

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM